PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G23000.1
Common NameATMYB37, MYB37, RAX1, T20O7.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 329aa    MW: 37045.4 Da    PI: 8.6791
Description myb domain protein 37
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G23000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l d+++++G+g +W + + + g++R++k+c++rw++yl
      AT5G23000.1 14 RGPWSPEEDSKLRDYIEKYGNGgNWISFPLKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding41.92.3e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +++  G++ W+ Ia++++ gRt++++k++w++
      AT5G23000.1  69 GDFSEEEDRIIFSLFAAIGSR-WSIIAAHLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.082962IPR017930Myb domain
SuperFamilySSF466893.27E-2712109IPR009057Homeodomain-like
SMARTSM007177.7E-101364IPR001005SANT/Myb domain
PfamPF002495.1E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-231569IPR009057Homeodomain-like
CDDcd001671.43E-81662No hitNo description
PROSITE profilePS5129423.36263117IPR017930Myb domain
SMARTSM007171.7E-1367115IPR001005SANT/Myb domain
PfamPF002492.5E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2370117IPR009057Homeodomain-like
CDDcd001674.62E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0007275Biological Processmulticellular organism development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRAPCCDKT KVKRGPWSPE EDSKLRDYIE KYGNGGNWIS FPLKAGLRRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDRIIF SLFAAIGSRW SIIAAHLPGR TDNDIKNYWN TKLRKKLLSS  120
SSDSSSSAMA SPYLNPISQD VKRPTSPTTI PSSSYNPYAE NPNQYPTKSL ISSINGFEAG  180
DKQIISYINP NYPQDLYLSD SNNNTSNANG FLLNHNMCDQ YKNHTSFSSD VNGIRSEIMM  240
KQEEIMMMMM IDHHIDQRTK GYNGEFTQGY YNYYNGHGDL KQMISGTGTN SNINMGGSGS  300
SSSSISNLAE NKSSGSLLLE YKCLPYFYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27141177108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249858_at0.0
Expression AtlasAT5G23000-
AtGenExpressAT5G23000-
ATTED-IIAT5G23000-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates in an adaxial ball-shaped set of cells in three to five cell layers around the L3 layer of the shoot apical meristem (SAM) in youg plantlets. Later, expressed transiently at the center of the boundary between the SAM and developing leaf primordia. In the inflorescence meristem, confined to the axils of flower primordia. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:16473968}.
UniprotTISSUE SPECIFICITY: Mostly expressed in roots. Also present in shoot tips and flower buds. {ECO:0000269|PubMed:16461581}.
Functional Description ? help Back to Top
Source Description
TAIR"Putative homolog of the Blind gene in tomato. Together with RAX2 and RAX3 belong to the class R2R3 MYB genes; encoded by the Myb-like transcription factor MYB37, regulates axillary meristem formation. RAX1 is expressed in a small central domain within the boundary zone separating SAM and leaf primordia during early leaf primordium development and is currently the earliest spatial marker for future axillary meristems. Member of the R2R3 factor gene family."
UniProtTranscription activator of genes involved in the regulation of meristematic competence, such as CUC2. Positively regulates axillary meristems (AMs) formation and development, especially at early phases of vegetative growth, probably by specifying a stem cell niche for AM formation. Modulates the negative regulation mediated by gibberellic acid on the timing of developmental phase transitions. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:16473968}.
Function -- GeneRIF ? help Back to Top
  1. rax mutants show new phenotypes that are characterized by defects in lateral bud formation in overlapping zones along the shoot axis. RAX genes are partially redundant in function and allow a fine-tuning of secondary axis formation
    [PMID: 16461581]
  2. RAX1 functions to positionally specify a stem cell niche for axillary meristem formation and affects the timing of developmental phase transitions by negatively regulating gibberellic acid levels in the shoot apex.
    [PMID: 16473968]
  3. ROX regulates axillary meristem formation redundantly with RAX1 and LAS.
    [PMID: 22372440]
  4. A LFY allele with reduced floral function revealed its ability to stimulate axillary meristem growth. This role requires the ability of LFY to bind DNA, and is mediated by direct induction of REGULATOR OF AXILLARY MERISTEMS1 (RAX1) by LFY.
    [PMID: 23445516]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G23000.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By a shift from short days to long days, in the axils of primordia on the elongating stem. {ECO:0000269|PubMed:16461581}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G07890(R), AT1G19570(R), AT2G37630(A), AT4G37750(A), AT5G53950(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G23000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1755070.0AK175507.1 Arabidopsis thaliana mRNA for myb like transcription factor (MYB37), complete cds, clone: RAFL21-93-G12.
GenBankAY5196280.0AY519628.1 Arabidopsis thaliana MYB transcription factor (At5g23000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197691.10.0transcription factor RAX1
SwissprotQ9FG680.0RAX1_ARATH; Transcription factor RAX1
TrEMBLR0FC290.0R0FC29_9BRAS; Uncharacterized protein
STRINGAT5G23000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140131623
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  4. Kroymann J,Donnerhacke S,Schnabelrauch D,Mitchell-Olds T
    Evolutionary dynamics of an Arabidopsis insect resistance quantitative trait locus.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100 Suppl 2: p. 14587-92
    [PMID:14506289]
  5. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  6. Ball L, et al.
    Evidence for a direct link between glutathione biosynthesis and stress defense gene expression in Arabidopsis.
    Plant Cell, 2004. 16(9): p. 2448-62
    [PMID:15308753]
  7. Müller D,Schmitz G,Theres K
    Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.
    Plant Cell, 2006. 18(3): p. 586-97
    [PMID:16461581]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Keller T,Abbott J,Moritz T,Doerner P
    Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development.
    Plant Cell, 2006. 18(3): p. 598-611
    [PMID:16473968]
  10. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  11. Textor S,de Kraker JW,Hause B,Gershenzon J,Tokuhisa JG
    MAM3 catalyzes the formation of all aliphatic glucosinolate chain lengths in Arabidopsis.
    Plant Physiol., 2007. 144(1): p. 60-71
    [PMID:17369439]
  12. Ehrenreich IM,Stafford PA,Purugganan MD
    The genetic architecture of shoot branching in Arabidopsis thaliana: a comparative assessment of candidate gene associations vs. quantitative trait locus mapping.
    Genetics, 2007. 176(2): p. 1223-36
    [PMID:17435248]
  13. Jeifetz D,David-Schwartz R,Borovsky Y,Paran I
    CaBLIND regulates axillary meristem initiation and transition to flowering in pepper.
    Planta, 2011. 234(6): p. 1227-36
    [PMID:21773792]
  14. Busch BL, et al.
    Shoot branching and leaf dissection in tomato are regulated by homologous gene modules.
    Plant Cell, 2011. 23(10): p. 3595-609
    [PMID:22039213]
  15. Yang F,Wang Q,Schmitz G,M
    The bHLH protein ROX acts in concert with RAX1 and LAS to modulate axillary meristem formation in Arabidopsis.
    Plant J., 2012. 71(1): p. 61-70
    [PMID:22372440]
  16. Chahtane H, et al.
    A variant of LEAFY reveals its capacity to stimulate meristem development by inducing RAX1.
    Plant J., 2013. 74(4): p. 678-89
    [PMID:23445516]
  17. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  18. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]